PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0139s0044.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 268aa    MW: 30237.5 Da    PI: 4.5678
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0139s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.3e-32119175258
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                          +Dgy+WrKYGqK +k+s++prsYYrCt ++C++kk+ve+s++dp+++++tYeg H h
  Kalax.0139s0044.1.p 119 EDGYKWRKYGQKFIKNSPNPRSYYRCTNPRCSAKKQVEKSSDDPETFIVTYEGLHLH 175
                          8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.3E-30109175IPR003657WRKY domain
PROSITE profilePS5081127.129113175IPR003657WRKY domain
SuperFamilySSF1182909.02E-27116175IPR003657WRKY domain
SMARTSM007743.6E-36118177IPR003657WRKY domain
PfamPF031064.0E-26119175IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDNESFEYWS AAEGDEILQE LLDDISPFFL IPSNGDSDDI DYGRWSLNEL LLSDAPYSGP  60
TVKDIEQALL EAGKRQRNEE VAKANHRASS MLENNDDSFR IENKYTLKMK SCGNGVMAED  120
GYKWRKYGQK FIKNSPNPRS YYRCTNPRCS AKKQVEKSSD DPETFIVTYE GLHLHFTYPY  180
LLQNQAPAAS ASASAQSLYD PPTKKQKTAQ ADGNNNEAAQ LHTYQEQLLL EECSFFDEAR  240
IGMESQGLLQ DVVPLMIRNS TSYGFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-201171791375WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006480891.16e-70PREDICTED: probable WRKY transcription factor 49
TrEMBLV4US323e-69V4US32_9R
STRINGVIT_08s0007g00570.t011e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.12e-41WRKY DNA-binding protein 49